PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT14792
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 194aa    MW: 21560.8 Da    PI: 8.1018
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT14792genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.86e-30106164159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDg++WrKYG+K vk+s++pr+YYrC+ +gC  kk+ver+++dp++v++tY+g Hnh 
  EMT14792 106 LDDGFKWRKYGKKAVKNSPNPRNYYRCSAEGCGIKKRVERDRDDPRYVVTTYNGVHNHA 164
               59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-3194166IPR003657WRKY domain
SuperFamilySSF1182902.09E-2798166IPR003657WRKY domain
PROSITE profilePS5081131.307101166IPR003657WRKY domain
SMARTSM007744.7E-33106165IPR003657WRKY domain
PfamPF031069.8E-24107163IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MAASLGLNPE GVFSSAFAHS SPFLGDHYAP PARAFIDDSD YAAHLHLHDD HQHYPFDQFE  60
YSPPMAQVSF AGAGDDEHRS EKTIKISARV SAGRIGFRTR SEVEILDDGF KWRKYGKKAV  120
KNSPNPRNYY RCSAEGCGIK KRVERDRDDP RYVVTTYNGV HNHATPGAAA QYYCYSPPRS  180
SPPAAYSAAG LLQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-2891166277Probable WRKY transcription factor 4
2lex_A6e-2891166277Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3571960.0AK357196.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1048A03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001309782.15e-64uncharacterized protein LOC107546771
TrEMBLR7W3P81e-143R7W3P8_AEGTA; Putative WRKY transcription factor 50
STRINGMLOC_12079.11e-127(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-41WRKY DNA-binding protein 50